DPCfam | MC155306
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.25 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3SSP9 | 395-541 | 146 | PPYFTTDWQCALSTPEQRRQFQEQEEKRFSMPWAPFVYNHHGYASVVAPVFRDGSGNRMRAALSARDHPLLRNDRPPWVSISEIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IL86-F1 | 505-661 | 100.00 | 86.80 | View in AlphaFoldDB ↗ |