DPCfam | MC155264
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 421 ± 56 aa |
| Residues in low-complexity regions (%) | 10.16 |
| Residues in coiled-coil regions (%) | 20.32 |
| Predicted disordered residues (%) | 46.57 |
| Average transmembrane regions | 1.15 |
| Dominant Pfam architecture(s) | PF15290 |
| Sequences matching dominant architecture (%) | 96.67 |
| Average overlap percent | 55.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9KD58 | 213-682 | 470 | IRDTYGASSRSSSSNSGSYKGSDSSPTIRRAGKYTSCSDNHGIKPPNPEQYLTPLQQKEVTIRHLRTKLKESENNLQERWESEVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1LUC0-F1 | 227-659 | 99.08 | 60.83 | View in AlphaFoldDB ↗ |