DPCfam | MC154675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 792 ± 124 aa |
| Residues in low-complexity regions (%) | 4.64 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 16.89 |
| Average transmembrane regions | 0.21 |
| Dominant Pfam architecture(s) | PF01602- PF07718- PF14806 |
| Sequences matching dominant architecture (%) | 87.07 |
| Average overlap percent | 92.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P45437 | 56-955 | 900 | LIMTIIRFVLPVQNHTIKKLLLIFWEIVPKTSADGKLLQEMILVCDAYRKDLQHPNEFLRGSTLRFLCKLKEPELLEPLMPAIRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZIA5-F1 | 96-945 | 99.88 | 82.96 | View in AlphaFoldDB ↗ |