DPCfam | MC154276
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Residues in low-complexity regions (%) | 0.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12932 |
| Sequences matching dominant architecture (%) | 88.1 |
| Average overlap percent | 51.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DB0425 | 1202-1275 | 74 | DQAELRAFPGPLIKGETHKVDVIKFSQSKGLECSRDNNLLDRDSARLLWDFIVLLCRQNGTVVGTDIADLLLKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O15027-F1 | 1488-1565 | 98.73 | 91.14 | View in AlphaFoldDB ↗ |