DPCfam | MC154170
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Residues in low-complexity regions (%) | 5.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01777 |
| Sequences matching dominant architecture (%) | 72.83 |
| Average overlap percent | 56.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U6PEV8 | 394-522 | 129 | MGKIMKPGKVVLVLRGKYAGRKALVVKAQDEGGADRSYPHAIIAGIDKYPLKVTKSMGKKKQEKRNKLKPFVKVVSYSHLLPTRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1XQU5-F1 | 4-126 | 100.00 | 94.68 | View in AlphaFoldDB ↗ |