DPCfam | MC154043
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Residues in low-complexity regions (%) | 2.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.98 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01982 |
| Sequences matching dominant architecture (%) | 91.1 |
| Average overlap percent | 85.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150IYA5 | 64-221 | 158 | ITLTEQGKNYLKTFFVDMCELFNKKNDELTIDGTIVSGIGEGKYYVSRPFYKKQFEDGLGFSPYPGTLNIKLTDETDILLRKFLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O28174-F1 | 105-231 | 99.22 | 95.15 | View in AlphaFoldDB ↗ |