DPCfam | MC15403
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 811 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Residues in low-complexity regions (%) | 1.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05139 |
| Sequences matching dominant architecture (%) | 89.79 |
| Average overlap percent | 25.32 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0HH45 | 61-202 | 142 | PKEDYEELMDAIGSARVVCIGDGSHGTLEFYRERAYITQRLIAEKGFNAVVAEADWPDAITINRYVQNTSKTPIKGAVDALKDFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NUA6-F1 | 33-148 | 88.70 | 93.60 | View in AlphaFoldDB ↗ |