DPCfam | MC154022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 11821 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Residues in low-complexity regions (%) | 2.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01979 |
| Sequences matching dominant architecture (%) | 53.86 |
| Average overlap percent | 6.21 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3YLH6 | 40-105 | 66 | NVHTLTFNDALVRPDQVVIVRHGRIVAMGSRTQVPVPEQARVIDGRGGYLLPGLVDGHVHLDGDGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2KCN5-F1 | 22-63 | 97.30 | 97.81 | View in AlphaFoldDB ↗ |