DPCfam | MC153546
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 323 ± 34 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00583- PF09337 |
| Sequences matching dominant architecture (%) | 49.15 |
| Average overlap percent | 70.56 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094ABZ8 | 1-327 | 327 | DLTPRQVTLRDRTTIATIVPFSSRYGVPPTLLQYLSDTMNKEIEGGDTYPMMDTMTTDAFATYWFQNFGAIMLLGTYASASAVTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NGE7-F1 | 38-354 | 98.11 | 90.11 | View in AlphaFoldDB ↗ |