DPCfam | MC153317
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 2.64 |
| Residues in coiled-coil regions (%) | 69.18 |
| Predicted disordered residues (%) | 42.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05911 |
| Sequences matching dominant architecture (%) | 97.67 |
| Average overlap percent | 21.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A176WR06 | 143-224 | 82 | MKQLRHVREEQEQRIHETMVKKTREYDKLRQEMEAKLADFGQHLQEARAEALESRGEARAMSNVLQEKTKALSEVGEAKARA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6JVW9-F1 | 144-222 | 100.00 | 95.19 | View in AlphaFoldDB ↗ |