DPCfam | MC153243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01136 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 30.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E2URR8 | 71-155 | 85 | LSTLALLEAESELKTLRKICENGRFTVEANDIGAVQILHQRHLPFTTGPSINIYNAETLKHLAAKGLTRWVMPLELGRETLQQMQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GY03-F1 | 66-150 | 100.00 | 97.13 | View in AlphaFoldDB ↗ |