DPCfam | MC15310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Residues in low-complexity regions (%) | 0.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14469 |
| Sequences matching dominant architecture (%) | 97.67 |
| Average overlap percent | 88.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000719D684 | 56-182 | 127 | NYIVENIQWPTIAEFTTEKALQKIDEFIRQTWKYSECWLFCIDFIREEIHPYSKRYIYIVKWSRPTKEHPIPRATASIYFTIELS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35817-F1 | 372-493 | 100.00 | 91.81 | View in AlphaFoldDB ↗ |