DPCfam | MC152987
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4951 |
|---|---|
| Mean domain length (aa) | 462 ± 89 aa |
| Residues in low-complexity regions (%) | 3.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.95 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13537- PF00733 |
| Sequences matching dominant architecture (%) | 64.82 |
| Average overlap percent | 84.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N9I3W7 | 20-287 | 268 | FSGELSNAAELRGSLRRLGRALVTGDDAEIVLQAYLEWGPALVSRLDGAYAFAVWDARDRKLVMVRDRLGIKPLHYHPTPDGVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P64248-F1 | 35-534 | 97.71 | 93.67 | View in AlphaFoldDB ↗ |