DPCfam | MC152886
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Residues in low-complexity regions (%) | 5.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07283 |
| Sequences matching dominant architecture (%) | 60.87 |
| Average overlap percent | 71.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003786C1D | 3-162 | 160 | NRLVLTIVICFAGCATSSSKVEASFGNFVADASPTQERLLADDATRQLVLLYPPASTRLEFRQVVADDFGKHLVEQLRGQGYALH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54916-F1 | 21-155 | 97.10 | 87.66 | View in AlphaFoldDB ↗ |