DPCfam | MC152660
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Residues in low-complexity regions (%) | 1.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.61 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF16978 |
| Sequences matching dominant architecture (%) | 98.48 |
| Average overlap percent | 92.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5KAL8 | 345-471 | 127 | LSPIPATTINPFYSLYSTVAAPPGVPSVSLELYFPHSKNPGHPVVAKVRKDATVEEVTGFGLWKYWDDGREPKLEEEGHKEERWS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9P7Y9-F1 | 255-386 | 97.78 | 73.21 | View in AlphaFoldDB ↗ |