DPCfam | MC15243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Residues in low-complexity regions (%) | 5.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16276 |
| Sequences matching dominant architecture (%) | 92.11 |
| Average overlap percent | 59.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A024R3V9 | 20-93 | 73 | QKDKNPSKNRKKLLKHLKGPSSVEDIKAKMQASIEKCGSLPKVEAKFISYVKNCFWMTEQEAIQDFWQWRKSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P16039-F1 | 210-294 | 100.00 | 71.76 | View in AlphaFoldDB ↗ |