DPCfam | MC152354
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1371 |
|---|---|
| Mean domain length (aa) | 293 ± 66 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02749- PF01729 |
| Sequences matching dominant architecture (%) | 53.91 |
| Average overlap percent | 97.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1DT30 | 15-273 | 259 | LEEDIGYRDLTTDSLDVDKNVEGFFIAKQSGVVAGTVFVKEVFNVFGDVSFQSFKKEGDYIEKGEIIGLVYGNCKSILKGERVAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95XX1-F1 | 34-419 | 98.05 | 96.20 | View in AlphaFoldDB ↗ |