DPCfam | MC152146
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 212 ± 47 aa |
| Residues in low-complexity regions (%) | 6.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.26 |
| Average transmembrane regions | 2.52 |
| Dominant Pfam architecture(s) | PF02516 |
| Sequences matching dominant architecture (%) | 86.31 |
| Average overlap percent | 27.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4KED8 | 3558-3798 | 241 | IFLVLYAVLGSYFAGVMVRLMLTLTPCVCVAAAMAASQLLDTFLTRWSPSAEAYEAAEDTAETAPKKSNKGLKSTTKPYVGIYTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1PJP5-F1 | 381-585 | 98.48 | 89.48 | View in AlphaFoldDB ↗ |