DPCfam | MC151887
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 305 ± 55 aa |
| Residues in low-complexity regions (%) | 10.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04904- PF04905 |
| Sequences matching dominant architecture (%) | 90.14 |
| Average overlap percent | 96.36 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A132A9U3 | 121-457 | 337 | TTQPSNESELQLYRVLQRANLLTYYDTFICQGGDDVQQLYEAGEEEFLEIMALVGMAAKPLHVRRLQKALHEWATNPSLFQSPLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044QVW2-F1 | 124-521 | 99.38 | 65.31 | View in AlphaFoldDB ↗ |