DPCfam | MC151710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 277 ± 40 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.81 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J2MGD4 | 15-325 | 311 | GNWNGLGVDVQRPASGKPNLRLLSGHNRRMQLVLGDQTLLWGTMSRCLYGVWLVRNRLLEQLPQTLVGPIDSLQVEQLLRLDPAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5Y7-F1 | 27-330 | 98.59 | 89.51 | View in AlphaFoldDB ↗ |