DPCfam | MC151707
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 366 ± 21 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.69 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF03200 |
| Sequences matching dominant architecture (%) | 20.75 |
| Average overlap percent | 21.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0IE29 | 325-701 | 377 | VSPRQRGTKASPHYRLTLAPGESATLRLRLRDDEAGPTEPEETLGTGFEETFRKRIEEADAFYATVIPADLPLDDLRVSRQAYAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H6A0-F1 | 292-674 | 100.00 | 91.97 | View in AlphaFoldDB ↗ |