DPCfam | MC151247
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 364 ± 36 aa |
| Residues in low-complexity regions (%) | 2.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.03 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X8IX26 | 317-626 | 310 | RLRRVRGYTRYPSLNAQSDSIIGDICLIGQPILALVRVGDTVALAAARVVSIQIGSTKASVESISIDHLDRSDVTFTAQILKLNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54GK9-F1 | 60-192 | 35.22 | 77.31 | View in AlphaFoldDB ↗ |