DPCfam | MC15111
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 330 ± 33 aa |
| Residues in low-complexity regions (%) | 11.48 |
| Residues in coiled-coil regions (%) | 15.9 |
| Predicted disordered residues (%) | 40.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13516 |
| Sequences matching dominant architecture (%) | 56.67 |
| Average overlap percent | 5.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060ZAU3 | 67-322 | 256 | MGGLRRVTLNCNTLVGDRGVAALAQELAEDLWVKALDLQKCGLSNDGTRSLLEALKSNSTLCVLDIRRNPLVDNDLMKSVIERVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JTW2-F1 | 226-558 | 100.00 | 66.20 | View in AlphaFoldDB ↗ |