DPCfam | MC150986
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.19 |
| Average transmembrane regions | 0.12 |
| Dominant Pfam architecture(s) | PF01055 |
| Sequences matching dominant architecture (%) | 95.35 |
| Average overlap percent | 20.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00096B0ED0 | 460-531 | 72 | VATQKYVETCSEFRTMSQVRVGWKTQHLSMLVTMRTKISDWGINNGLKGLIATLLQMNINGYTYVLPDIIGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VBR6-F1 | 425-501 | 98.72 | 96.22 | View in AlphaFoldDB ↗ |