DPCfam | MC150694
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 173 ± 33 aa |
| Residues in low-complexity regions (%) | 3.43 |
| Residues in coiled-coil regions (%) | 0.15 |
| Predicted disordered residues (%) | 16.76 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF16507 |
| Sequences matching dominant architecture (%) | 94.48 |
| Average overlap percent | 38.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M3K7T6 | 246-391 | 146 | REPLRYHAIVLLDCLVSAIDINDIVKLSLAFRIIETFFALIPVVDCSEALRMESYETLSEDDKNLCILTAALPKIVTKLMDRVFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R2X6-F1 | 462-632 | 99.42 | 90.62 | View in AlphaFoldDB ↗ |