DPCfam | MC150629
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 118 ± 26 aa |
| Residues in low-complexity regions (%) | 3.15 |
| Residues in coiled-coil regions (%) | 1.12 |
| Predicted disordered residues (%) | 13.04 |
| Average transmembrane regions | 0.17 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K3VE48 | 415-582 | 168 | VRLLSQRIELEAEKRIREASDSRLLNRYMQARRTAEDILILVQELQAENLADFWLPSSAFALSTTVSFLLRCALETENSTSGLVQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H7J5-F1 | 501-616 | 95.90 | 92.21 | View in AlphaFoldDB ↗ |