DPCfam | MC150602
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 250 ± 38 aa |
| Residues in low-complexity regions (%) | 2.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.17 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084RTE5 | 12-296 | 285 | HLDTDHRDAFSRAVQAILATDLAEKTMAQLVDGLSQAYVAWEARGNSLTKAHPLADHEQLCSGVLEKTQSLRDDFGPESLSFDSH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PYH7-F1 | 11-301 | 99.26 | 93.01 | View in AlphaFoldDB ↗ |