DPCfam | MC150543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 303 ± 51 aa |
| Residues in low-complexity regions (%) | 2.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.38 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6NUY0 | 95-435 | 341 | AFSQKSGYFPKPHGVKIVALVPFHYHERTEILDCYLQKNLVRNHGFLDQVVFIPQTADPVSLEWLYSLIKQTPEYAISPPGYNME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1HDV8-F1 | 76-405 | 99.38 | 95.93 | View in AlphaFoldDB ↗ |