DPCfam | MC15032
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 236 ± 38 aa |
| Residues in low-complexity regions (%) | 14.51 |
| Residues in coiled-coil regions (%) | 4.72 |
| Predicted disordered residues (%) | 46.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08653 |
| Sequences matching dominant architecture (%) | 93.22 |
| Average overlap percent | 22.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U7KPH4 | 12-240 | 229 | YPDAPHGLGFLEPAMGELLDEVETLQTNVHGLHNLSDALGTFNESFASWLYVMNMNALTTDWPQAPTDASFKLAARRAEEDIHIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NH88-F1 | 51-179 | 55.88 | 71.55 | View in AlphaFoldDB ↗ |