DPCfam | MC149921
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Residues in low-complexity regions (%) | 25.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.48 |
| Average transmembrane regions | 1.99 |
| Dominant Pfam architecture(s) | PF03729 |
| Sequences matching dominant architecture (%) | 2.56 |
| Average overlap percent | 51.14 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W9YPR4 | 7-95 | 89 | DPVDHSRTYRQHAGEAMKAGKNAPGIVSVGLGVLAMVIGLFSFANGTRTAGVVAVILAVVLIAGGLFWLNRFHRKVKEQQVEWHR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F6M4-F1 | 26-106 | 95.29 | 73.31 | View in AlphaFoldDB ↗ |