DPCfam | MC149918
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1701 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Residues in low-complexity regions (%) | 2.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.16 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01161 |
| Sequences matching dominant architecture (%) | 91.89 |
| Average overlap percent | 70.99 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183IZL1 | 42-193 | 152 | VSTSPANLLEVKYAGDLVVDLGNTLKPSQVKNEPVHIKWPTESGALYTVIFTDPDAPSRKNPTFREWRHWLIVNVPSSGDISQGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044VAJ6-F1 | 58-197 | 97.41 | 97.66 | View in AlphaFoldDB ↗ |