DPCfam | MC149834
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 318 ± 36 aa |
| Residues in low-complexity regions (%) | 1.1 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 26.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06067 |
| Sequences matching dominant architecture (%) | 47.3 |
| Average overlap percent | 51.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A28680D | 25-366 | 342 | AAKLDVVTPACHLVADNGHLRLIGVGEPQLTPDGVTVGETVLRPTAVADAGIAEKLGIPLPYLRRLRAEQLGLYDANVNTWLADD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F0D3-F1 | 31-409 | 99.37 | 87.32 | View in AlphaFoldDB ↗ |