DPCfam | MC149654
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 239 ± 31 aa |
| Residues in low-complexity regions (%) | 11.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.06 |
| Average transmembrane regions | 2.67 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5DBT3 | 688-878 | 191 | QRYWNEFDDGDEAPEEEPYTLFVDPNESSAFPGAAALSHLATVITSHAQHQTEKIRSWFHPQSTTPLTSDRAPLIPSTSSYFSPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PLX7-F1 | 245-529 | 99.18 | 61.21 | View in AlphaFoldDB ↗ |