DPCfam | MC149589
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Residues in low-complexity regions (%) | 7.08 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 5.53 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF07850 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 70.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00067E11EF | 285-343 | 59 | NNSNITADSNFSAIFNIILWFSIVFAFSLVAIVYAIMDMDPGRDSIIYRMTSTRMKKDN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VHG4-F1 | 261-319 | 98.33 | 82.23 | View in AlphaFoldDB ↗ |