DPCfam | MC149585
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 185 ± 25 aa |
| Residues in low-complexity regions (%) | 1.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.64 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01015 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 94.98 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3N1P1 | 3-178 | 176 | PLMFNIRNTGKMLVPRTQGAKIASDVLKGHVFEVSLADLKNNEIIFRKFKLTTEDIEGKCCLSKFHGMELTYETKYSRIKNMVPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P61246-F1 | 19-219 | 100.00 | 93.06 | View in AlphaFoldDB ↗ |