DPCfam | MC14958
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.5 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF03403 |
| Sequences matching dominant architecture (%) | 7.04 |
| Average overlap percent | 27.33 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7ZJN9 | 379-556 | 178 | PSFFYEKTEAANLATVQGLALQDPTNDIVTAAADVQVHQGAITLPYFQSLPGETGAGIVTGKWAGSTSLEAALNETLTPGDTIFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KL83-F1 | 321-481 | 98.65 | 97.49 | View in AlphaFoldDB ↗ |