DPCfam | MC14952
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Residues in low-complexity regions (%) | 2.56 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 13.15 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05068 |
| Sequences matching dominant architecture (%) | 39.15 |
| Average overlap percent | 72.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A9JGQ4 | 15-108 | 94 | FELIQAENDRGAALLAAVFAEATLESLILDRLIPNSGKQKLPVNNFAAKIDLSFRLGIIPEGVANLLHGLRDIRNIFAHQIISDF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0AF10-F1 | 33-142 | 99.06 | 93.57 | View in AlphaFoldDB ↗ |