DPCfam | MC149470
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Residues in low-complexity regions (%) | 11.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00063 |
| Sequences matching dominant architecture (%) | 2.86 |
| Average overlap percent | 13.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8GB51 | 988-1076 | 89 | LAVWKIILRFMGELPEPVLYAPNSSSERSSVITQIYDTLTRKNNMSAGIKANSPRVNRKGKGKEISSMKLKRASKLAGQVSRQLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286Y9F5-F1 | 1050-1142 | 98.94 | 46.78 | View in AlphaFoldDB ↗ |