DPCfam | MC149441
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Residues in low-complexity regions (%) | 7.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.46 |
| Average transmembrane regions | 0.48 |
| Dominant Pfam architecture(s) | PF13472 |
| Sequences matching dominant architecture (%) | 98.77 |
| Average overlap percent | 20.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1QGJ6 | 2-114 | 113 | NLIKHLWQNLATILVVALLAFGGWQLFGPKVEPTRLAGVTTKVKHLNVVGVGDSLTHGVGDATDSGGYVELIKRDLEQSGDYTVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P2Q4-F1 | 8-111 | 93.52 | 88.54 | View in AlphaFoldDB ↗ |