DPCfam | MC149379
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Residues in low-complexity regions (%) | 0.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00135 |
| Sequences matching dominant architecture (%) | 52.0 |
| Average overlap percent | 13.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4YWA1 | 413-502 | 89 | EPAAEGDNYWPKYTIPELEYKELSLGLTTDRAVRANECAFWNYYVPDLIRFIESVTEDEKEWREDFEMWQVDMEEWRNVFDEYQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P21836-F1 | 519-611 | 97.92 | 86.16 | View in AlphaFoldDB ↗ |