DPCfam | MC149325
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 331 ± 52 aa |
| Residues in low-complexity regions (%) | 9.2 |
| Residues in coiled-coil regions (%) | 2.24 |
| Predicted disordered residues (%) | 33.58 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF13365 |
| Sequences matching dominant architecture (%) | 68.63 |
| Average overlap percent | 33.95 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q80KJ8 | 400-792 | 393 | VDIKGPDGKIKETQNANPSWITKMSGLKNFFQRAFRQKVRTGVNPTTRIIPNSLVVIDAKDGRGTGFRVRNYLVTAGHVVGADTT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W106-F1 | 281-449 | 45.02 | 89.13 | View in AlphaFoldDB ↗ |