DPCfam | MC149181
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 205 ± 37 aa |
| Residues in low-complexity regions (%) | 4.91 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 38.06 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10056 |
| Sequences matching dominant architecture (%) | 95.09 |
| Average overlap percent | 40.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1HDF0 | 61-198 | 138 | RQGPPPGYVFVPKGDIYNNSQLSKSFTRDETDGIYRLQPQTRRTLDLDAPSQSASSTLAVRTTASPKRTHETSRKPALTSALNSP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W238-F1 | 69-276 | 99.49 | 84.43 | View in AlphaFoldDB ↗ |