DPCfam | MC148497
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Residues in low-complexity regions (%) | 0.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10347 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 61.69 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5DC93 | 1290-1391 | 102 | SEDFYSLCIDKSLSTVKLYSDMKFKISPSDPARFVWGQSYQFGIQQIMLNMDQFSKPPVDPSPKLGFWDKLRLIFHGKFEVTSDT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q06179-F1 | 1360-1455 | 94.95 | 82.67 | View in AlphaFoldDB ↗ |