DPCfam | MC148460
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Residues in low-complexity regions (%) | 10.43 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 1.28 |
| Average transmembrane regions | 3.42 |
| Dominant Pfam architecture(s) | PF09900 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 93.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5UBJ3 | 12-161 | 150 | LHGLFETSLWIKALFALSEIVAGAAAYFIPSHVVLTFVLRITGHELREDPHDVVAGVLLHAAQHLSLGSQAFAAVYLLAHGVLKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EP66-F1 | 71-223 | 98.63 | 89.29 | View in AlphaFoldDB ↗ |