DPCfam | MC148304
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 173 ± 18 aa |
| Residues in low-complexity regions (%) | 3.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 5.56 |
| Average overlap percent | 33.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V3ZEF6 | 1223-1363 | 141 | HCFELSIEGIKNLKLFENMIWGEADCFVQYHFPTQLETDGVKHATPTLRSYRTGTTLCIPDPVFNDGNRHRITLDQGVPVQRELL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0JM13-F1 | 971-1148 | 99.44 | 74.79 | View in AlphaFoldDB ↗ |