DPCfam | MC148120
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 90 ± 16 aa |
| Residues in low-complexity regions (%) | 2.92 |
| Residues in coiled-coil regions (%) | 0.53 |
| Predicted disordered residues (%) | 2.37 |
| Average transmembrane regions | 2.03 |
| Dominant Pfam architecture(s) | PF10321 |
| Sequences matching dominant architecture (%) | 96.64 |
| Average overlap percent | 47.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158QPA5 | 491-576 | 86 | PRAAKGRNYKVQVQIFVQVLLICSTTAIAATLHVFMIFFTVSRNAVITACVSWQLSHGLHGIIYLSFNRDIRYEVMKMFTIKKCR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q400M3-F1 | 227-312 | 92.47 | 83.12 | View in AlphaFoldDB ↗ |