DPCfam | MC148117
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 194 ± 13 aa |
| Residues in low-complexity regions (%) | 36.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.37 |
| Average transmembrane regions | 5.28 |
| Dominant Pfam architecture(s) | PF19053 |
| Sequences matching dominant architecture (%) | 7.69 |
| Average overlap percent | 53.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S3X696 | 285-458 | 174 | AQIHLPALPNTADDILADEEPVQPDIVSRAVFADRLLAAMLTAACIDIVLFCLLLLPHGGGWHVGLATCAGLALMMRARAFVGFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0END9-F1 | 299-451 | 75.77 | 94.48 | View in AlphaFoldDB ↗ |