DPCfam | MC148005
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 189 ± 33 aa |
| Residues in low-complexity regions (%) | 6.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00646 |
| Sequences matching dominant architecture (%) | 1.96 |
| Average overlap percent | 17.26 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2T711 | 1-162 | 162 | MVVLVDLEDDEAPSLQSPHASGLLNVKPLHHSLSESTAESGQRVSVADERPNPNKSGFSAALSCYPIVSQLAAQLDLNTLHDLSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W1R4-F1 | 1-192 | 100.00 | 65.61 | View in AlphaFoldDB ↗ |