DPCfam | MC147949
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 248 ± 44 aa |
| Residues in low-complexity regions (%) | 10.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.76 |
| Average transmembrane regions | 5.13 |
| Dominant Pfam architecture(s) | PF01478 |
| Sequences matching dominant architecture (%) | 35.37 |
| Average overlap percent | 42.66 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D5C261 | 17-225 | 209 | VMLGVASVIDVWKREIHDYFWIVFGVIGFLLIFLSPDLMSDLLTLGFALIIAPIVIIMWRIGFFGGADAFALIALAVIAPMATLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5UZH5-F1 | 11-330 | 100.00 | 85.62 | View in AlphaFoldDB ↗ |