DPCfam | MC147938
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Residues in low-complexity regions (%) | 11.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00063- PF00612- PF00612 |
| Sequences matching dominant architecture (%) | 1.37 |
| Average overlap percent | 17.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8GB51 | 867-1007 | 141 | MLARNEYRRIRRNEYLSQQDWEAAEKRKEMQKALLMQQEKENLEMVEQVFGFLPAMDMDASPFSDETDLDTLLHEPDKEEEFTFP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1Q777-F1 | 881-1030 | 98.68 | 58.00 | View in AlphaFoldDB ↗ |